PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG175500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 240aa    MW: 27578.4 Da    PI: 9.2887
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG175500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.14.9e-281059251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         ri+n++ rqvtfskRrngi+KKA EL +LCdaev ++ifsstg+lyey+s
  Pavir.7NG175500.1.p 10 RIDNSTSRQVTFSKRRNGIFKKARELAILCDAEVGLVIFSSTGRLYEYAS 59
                         8***********************************************86 PP

2K-box89.27.9e-3076169598
                K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                          + +++ +++ + +q+e+a L+++++nLq+++R+l+G+dL+ L +keLq+Le++Le sl+ iR+kK++ll+++i+el +k   +q++n++L
  Pavir.7NG175500.1.p  76 QLVANPNTELKFWQREAASLRQQLHNLQENHRQLMGQDLSGLGVKELQNLENRLEMSLRCIRTKKDQLLVDEIHELNRKGSLIQQDNMEL 165
                          5566788999******************************************************************************** PP

                K-box  95 rkkl 98 
                           kk+
  Pavir.7NG175500.1.p 166 YKKV 169
                          *998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.791161IPR002100Transcription factor, MADS-box
CDDcd002655.12E-45277No hitNo description
SuperFamilySSF554552.35E-32288IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-283859IPR002100Transcription factor, MADS-box
PfamPF014862.6E-2882169IPR002487Transcription factor, K-box
PROSITE profilePS5129715.6485175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGIFK KARELAILCD AEVGLVIFSS TGRLYEYAST  60
SMKSVIDRYG RAKEEQLVAN PNTELKFWQR EAASLRQQLH NLQENHRQLM GQDLSGLGVK  120
ELQNLENRLE MSLRCIRTKK DQLLVDEIHE LNRKGSLIQQ DNMELYKKVN LIRQENVELY  180
KKLYEKEATG EVNRDSTTPY NFAVVENDNT PIHLELNTPP QENNVEQPSP PKLGLQLSP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-20174174Myocyte-specific enhancer factor 2B
1tqe_Q8e-20174174Myocyte-specific enhancer factor 2B
1tqe_R8e-20174174Myocyte-specific enhancer factor 2B
1tqe_S8e-20174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00410DAPTransfer from AT3G57230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975863.11e-157PREDICTED: MADS-box transcription factor 27-like
SwissprotQ6EP491e-144MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A059Q1L51e-158A0A059Q1L5_9POAL; MADS-box transcription factor
STRINGOB04G22330.11e-152(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.18e-98AGAMOUS-like 16